PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149416.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 331aa    MW: 36176.2 Da    PI: 9.8295
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149416.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822199.31.3e-61181482141
          DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqs 96 
                     +++rkp+w+ErEnn+rRERrRRa+aakiy GLRaqGny+lpk++DnneVlkALc eAGwvve+DGttyrkg kpl   ++agss++a+p ss+  
  XP_009149416.1  18 ATRRKPSWRERENNRRRERRRRAVAAKIYNGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPL-PGDMAGSSSRATPYSSSY- 110
                     689************************************************************************.9**********9999966. PP

          DUF822  97 slkssalaspvesysaspksssfpspssldsislasaasllpvls 141
                       + s ++sp+ sy+ sp+sssfpsps+ d+is+     ++p+l+
  XP_009149416.1 111 --NQSPFESPILSYQVSPSSSSFPSPSRGDNIST-----IFPFLR 148
                     ..899*************************9954.....455555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.4E-5819142IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MTSDGATSTS AAAAAALATR RKPSWREREN NRRRERRRRA VAAKIYNGLR AQGNYNLPKH  60
CDNNEVLKAL CSEAGWVVEE DGTTYRKGHK PLPGDMAGSS SRATPYSSSY NQSPFESPIL  120
SYQVSPSSSS FPSPSRGDNI STIFPFLRNG GIPSSLPPLR ISNSAPVTPP VSSPTSKHPK  180
PLPTWESFTK QSMAIAAKQS MSSFNYPFYA VSAPASPTHH RQFNAPATIP ECDESDASTV  240
DSGHWISFQK FSQQQQPFHG VSSAVPASPT FNLVKPPVPQ RLSPNTAGIQ EIGQSSEFKF  300
ENRQVTPWEG ERIHDVAMED LELTLGNTKG R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11938RRKPSWRERENNRRRERRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.65610.0flower| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893560.0AC189356.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149416.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2
RefseqXP_009149417.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2
RefseqXP_009149418.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2
RefseqXP_013641895.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2
SwissprotQ9LN630.0BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBLA0A078IMH10.0A0A078IMH1_BRANA; BnaA06g13620D protein
TrEMBLM4EAC50.0M4EAC5_BRARP; Uncharacterized protein
STRINGBra025733.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24722772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.31e-143BES1 family protein